Курсовая работа по биоинформатике




Скачать 80.56 Kb.
НазваниеКурсовая работа по биоинформатике
А Н Белозерского
Дата конвертации01.10.2012
Размер80.56 Kb.
ТипКурсовая



Московский Государственный Университет

им. М. В. Ломоносова

Факультет биоинженерии и биоинформатики


КУРСОВАЯ РАБОТА

ПО БИОИНФОРМАТИКЕ .

Тема : идентификация белка , исследование его аминокислотной последовательности и построение филогенетического древа гомологов .


Автор : Кочмак С.А.

202 группа.

e-mail:kochmak@belozersky.msu.ru

Кураторы : Филиппов П.П. , Сесин И.И.

Отдел сигнальных систем клетки НИИ физико-химической биологии им.А.Н.Белозерского


II семестр 2002-2003 г.

III семестр 2003-2004 г.


Содержание


1.Введение 3

1.1 Семейство аннексинов 3

1.2 Постановка задачи 4

2.Материалы и методы 4

3.Результаты 5

3.1 Идентификация белка 5

3.2 Поиск консенсусных последовательностей 5

3.3 Построение филогенетического древа 7

4.Литература 9


1.Введение .

1.1 Семейство аннексинов . Аннексины ( от греч. Annex – связывать , удерживать вместе ) - общее название семейства кальций- и фосфолипидсвязывающих белков , образующих эволюционно консервативную группу с представителями, экспрессирующимися и в растительном и в животном царствах ( на сегодняшний день известно порядка 160 белков , относимых к этому семейству , и представленных в более чем 65 видах : от грибов и протистов до растений и высших позвоночных ) . Структурно аннексины характеризуются наличием 4 доменов ( 8 в аннексине VI ) , которые сходны друг с другом по своим первичным и вторичным структурам , образованы пятью -цепями и расположены симметрично (Рис. 1 ) .

Р
ис. 1 . Аннексин IV



Многие из этих доменов были закристаллизованы , и их молекулярная структура помогла выявить некоторые интересные черты архитектуры Ca2+связывающих сайтов и центральной гидрофильной поры ( которую образуют домены ) , предположительно функционирующей в качестве кальциевого канала . Наряду с консервативными доменами , все аннексины содержат в N-концевой части уникальную последовательность , определяющую их индивидуальные свойства in vivo ( например , N-концевая часть аннексина II связывает белок р11 ) .

Биохимически аннексины - хорошо растворимые белки , способные к Ca2+зависимому связыванию с биомембранами , при повышении концентрации

кальция могут образовывать тримеры . Другими лигандами аннексинов являются S100 белки , цитоскелет-ассоциированные белки , нуклеиновые кислоты и углеводы , в частности гликозаминогликаны . Полностью биологическое значение неплохо описанного in vitro Ca2+зависимого связывания с фосфолипидами в настоящее время не понято .

Физиологическая роль многих представителей данного семейства остается неясной : предполагаемые функции включают ингибирование свертывания крови ( в том числе предотвращение образования тромбов ) , регуляцию активности фосфолипазы A2 , участие в эндо- и экзоцитозе , взаимодействие с элементами цитоскелета . Аннексины A2 , A5 и A6 участвуют в регуляции сердечной деятельности ( хорошо известна роль кальция для сердца ) . В литературе сообщалось также о связи аннексинов с процессами клеточной пролиферации , дифференцировки и трансформации ; для начальных стадий апоптоза характерно увеличение их концентрации .По последним данным , представители семейства аннексинов могут быть вовлечены в клеточный ответ на стресс : аннексин А1 может выступать в роли шаперона , предотвращая температурную инактивацию глутаматдегидрогеназы . Было показано, что некоторые цитостатики индуцируют в клетках немелкоклеточного рака легкого синтез аннексина IV , который начинает концентрироваться в ядрах этих клеток. Хотя аннексины и не содержат сигнальных последовательностей для секреции , некоторые из них были обнаружены вне клеток , где они могли ингибировать миграцию нейтрофилов , выполнять функцию рецепторов для некоторых протеаз в эндотелии . Функциональные свойства всех аннексинов обусловлены наличием Ca-связывающих участков . Наконец , нарушения экспрессии , активности или локализации представителей данного семейства предположительно коррелируют с некоторыми заболеваниями ( болезней человека , связанных с мутацией в гене аннексина , не описано ) : промиелоцитарной лейкемией , различными аннексинопатиями . При различных лейкемиях , меланоме и раке простаты происходит изменение экспрессии генов аннексинов ( А5 , А9 ) .


1.2 Постановка задачи . В предложенной задаче было необходимо :

1) Определить не идентифицированный белок , выделенный и очищенный из сетчатки глаз быка ( BOS TAURUS )

2) Найти консенсусные последовательности , указывающие на наличие в нем ковалентных модификаций

3) Осуществить поиск гомологов и построить филогенетическое древо .

По результатам масспектрометрического анализа данный белок

был идентифицирован как аннексин IV ( синонимы : липокортин IV , эндонексин I )(Авдеева О., 202 группа ) . Это первый случай обнаружения аннексина IV в сетчатке глаза . Для подтверждения результата этот белок был подвергнут протеолитическому расщеплению; из полученного гидролизата методом высокоэффективной жидкостной хроматографии (ВЭЖХ) очищены до гомогенного состояния 2 полипептидных фрагмента; путем секвенирования этих фрагментов установлена их аминокислотная последовательность :


1)AAKGGTVKA ASGFNAA


2)DEVKFLTVLCSR NRNHLLHVFD


2.Материалы и методы .

Были использованы следующие программы :

  1. Blast (http://cn.expasy.org/tools/blast) – для идентификации белка и поиска его гомологов .

  2. Protdist , Bionj и DrawTree из пакета программ Phylip (http://bioweb.pasteur.fr) – построение филогенетического древа гомологов .

  3. RasMol ( версия 2.7.2 ) – визуализация молекулы аннексина IV .

и банки :

1) SwissProt

2) Prosite (http://kr.expasy.org/prosite) для поиска консенсусных последо-

вательностей .


3.Результаты .

3.1 Идентификация белка . Наиболее близким гомологом оказался ANX4_BOVIN ( процент сходства = 100)(рис . 2) . Другие белки (с меньшим процентом сходства ) также принадлежат семейству аннексинов .При этом пептид (1) точно совпадает с N-концевой частью ANX4 (которая является вариабельной и отличает каждый отдельно взятый представитель семейства) . Пептид (2)- гомологичен всему семейству аннексинов т.к. входит в состав т.н. аннексин-подобных повторов , служащих для связывания двухвалентных ионов кальция .


Р
ис. 2


3.2 Поиск консенсусных последовательностей .(О посттрансляционных модификациях аннексинов известно давно ) . В результате обнаружены сайты фосфорилирования двух типов , гликозилирования , миристилирования и 4 аннексиновых повтора ( см . приложение ) . Необходимо отметить , что данные сайты могут являться случайными последовательностями . Наличие сайтов гликозилирования и миристилирования подтверждает , что аннексин IV может является мембранным белком (т.к. обычно гликозилированы мембранные , а не цитоплазматические белки и остаток миристиновой кислоты служит для заякоривания участков белка в билипидном слое ) ( Рис. 3 ) .




Рис. 3 . Аннексин IV : красным цветом выделен I аннексиновый повтор , желтым - II , зеленым - III ,синим – IV ; черным – ионы кальция .

Для N-концевой части аннексина (взяты 1-30 аминокислоты до первого аннексинового повтора) теоретически возможны сайты : миристилирования и 2 сайта фосфорилирования для протеинкиназы С ( для полной активации которой требуется присутствие ионов Ca2+ , диацилглицерола и связь с фосфолипидами внутренней поверхности плазматической мембраны , преимущественно с фосфатидилсерином ) . Экспериментально известно , что ,

по крайней мере in vitro , в аннексине IV фосфорилируется остаток треонина-6 .

Консенсусные последовательности :



N-glycosylation site.

Prosite access number: PS00001

Prosite documentation access number: PDOC00001

N-{P}-[ST]-{P}.

Randomized probability: 5.138e-03 .

Site : 124 to 127 NQTY. Identity.

Site : 244 to 247 NKSA. Identity.

---------------------------------------------------------------------

Protein kinase C phosphorylation site.

Prosite access number: PS00005

Prosite documentation access number: PDOC00005

[ST]-x-[RK].

Randomized probability: 1.423e-02 .

Site : 6 to 8 TVK. Identity.

Site : 21 to 23 TLR. Identity.

Site : 222 to 224 SIK. Identity.

Site : 256 to 258 SMK. Identity.

---------------------------------------------------------------------

Casein kinase II phosphorylation site.

Prosite access number: PS00006

Prosite documentation access number: PDOC00006

[ST]-x(2)-[DE].

Randomized probability: 1.482e-02 .


Site : 31 to 34 TDED. Identity.

Site : 116 to 119 TPEE. Identity.

Site : 134 to 137 SLED. Identity.

Site : 230 to 233 SFED. Identity.

Site : 262 to 265 TDDD. Identity.

Site : 273 to 276 SRAE. Identity.

Site : 302 to 305 TSGD. Identity.

---------------------------------------------------------------------

N-myristoylation site.

Prosite access number: PS00008

Prosite documentation access number: PDOC00008

G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}.

Randomized probability: 1.397e-02 .

Site : 5 to 10 GTVKAA. Identity.

Site : 102 to 107 GTDEGC. Identity.

---------------------------------------------------------------------

Annexins repeated domain signature.

Prosite access number: PS00223

Prosite documentation access number: PDOC00195

[TG]-[STV]-x(8)-[LIVMF]-x(2)-R-x(3)-[DEQNH]-x(7)-[IFY]-x(7)-[LIVMF]-x(3)-[LIVMF]

-x(11)-[LIVMFA]-x(2)-[LIVMF].

Randomized probability: 7.279e-08 .

Site : 30 to 82 GTDEDAIINVLAYRSTAQRQEIRTAYKTTIGRDLMDDLKSELSGNFEQVILGM. Identity.

Site : 102 to 154 GTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSL. Identity.

Site : 186 to 238 GTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAI. Identity.

Site : 261 to 313 GTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLIL. Identity.

(Casein kinase II – активируется циклическими мононуклеотидами фосфорилирует серин или треонин ) .


3.3 Построение филогенетического древа . Получено около 60 гомологов, аминокислотная последовательность которых была выровнена ( при этом 2 последовательности , у которых отсутствовала большая часть консервативного участка , были удалены ) (Рис. 4) .


.


Рис . 4 . Филогенетическое древо гомологов аннексина IV .( HUMAN - Homo sapiens ; MOUSE- Mus musculus ; RAT - Rattus norvegicus ; CAVCU - Cavia cutleri (Guinea pig) ; PIG - Sus scrofa (Pig) ; CHICK - Gallus gallus (Chicken) ; CANFA - Canis familiaris (Dog) ; BOVIN - Bos Taurus ; RABIT- Oryctolagus cuniculus (Rabbit);

COLLI - Columba livia (Domestic pigeon) ; XENLA - Xenopus laevis (African clawed frog ; DROME - Drosophila melanogaster; HYDAT - Hydra attenuate ; ; DICDI - Dictyostelium discoideum (Slime mold) ; RODSP - Rodentia sp ; FRAAN - Fragaria ananassa (Strawberry) ; CYNPY - Cynops pyrrhogaster (Japanese common newt) ; GIALA - Giardia lamblia (Giardia intestinalis) .


В процессе эволюции возникли механизмы , поддерживающие внутриклеточную концентрацию кальция на строго определенном уровне , т.к. кальций является одним из важнейших вторичных мессенджеров (концентрации других двухвалентных катионов , в первую очередь магния и цинка , внутри клетки могут в тысячи раз превышать коцентрацию кальция ) , и , несомненно , один из таких механизмов реализируется семейством аннексинов . К числу простейших организмов , в которых экспрессируются аннексины , относятся Giardia lamblia и Neurospora crassa , Hydra vulgaris и Dictyostelium discoideum .В настоящее время аннексины D. discoideum и N. сrassa считаются ортологами (их аминокислотные последовательности схожи на 40 % ) . Вторая важнейшая группа аннексинов была описана в растениях . Аннексины растений характеризуются отсутствием вариабельной N-концевой части и Ca2+связывающих сайтов во II и III повторах (по крайней мере в современных цветковых растениях ), что свидетельствует о различных путях эволюции аннексинов растений и животных . Аннексин из Arabidopsis thaliana обладает каталазной активностью , у аннексинов животных ферментативной активности вообще не обнаружено . Аннексины растений и беспозвоночных не имеют ортологов у млекопитающих . Аннексин А13 позвоночных рассматривается в качестве предшественника аннексина А7 , А7 – аннексина А11 . Анализ структуры гена аннексина А11 привел к выводу , что последний является общим предком 9 аннексинов ( А1, А2, А3, А4, А5, А6, А8, А9и А10 ) . Консервативность двенадцати аннексинов млекопитающих в течение 100 миллионов лет еще раз подчеркивает их важную физиологическую роль .


4.Литература .


  1. Gerke V. , Моss SE. Annexins : From Structure to Function . Phisiol Rev 82 :

331-371,2002 .

  1. Zanotty G. , Malpeli G. , Gliubich F. , Folli C. , Stoppini M. , Olivi L. , Savoia A.,

Berni R. Structure of the trigonal crystal form of bovine annexin IV . Biochem. J.

329 : 101-106 , 1998 .

3) Iglesias J. , Morgan R. , Jenkins N. , Copeland N. , Gilbert D. , Fernandez M.

Comparative Genetics and Evolution of Annexin A13 as the founder Gene of Verterbrate Annexins .Mol. Biol. Evol.19(5):608-618 , 2002 .

Похожие:

Курсовая работа по биоинформатике iconКурсовая работа по курсу "Организация эвм и систем"
Курсовая   работа  "Программно-аппаратное   конфигурирование   вычислительной   системы"  
Курсовая работа по биоинформатике iconКурсовая   работа   по   учебной   дисциплине   является   одним   из 
Курсовая работа выполняется студентом на третьем курсе по любой  из изучаемых дисциплин
Курсовая работа по биоинформатике iconКурсовая работа
Курсовая работа подтверждает развитие исследовательских навыков студентов и углубленное освоение учебного материала соответствующего...
Курсовая работа по биоинформатике iconКурсовая  работа  по  организации  производства  и  менеджменту  в  ма
...
Курсовая работа по биоинформатике icon  Курсовая работа является видом учебной и научно-исследовательской 
...
Курсовая работа по биоинформатике iconКурсовая  работа  способствует  формированию  у  студента  навыков 
Курсовая работа является одним из важнейших видов учебного процесса  и выполняется студентом в соответствии с учебным планом. 
Курсовая работа по биоинформатике iconКурсовая работа по дисциплине «Компьютерная графика»
Данная курсовая работа посвящена планировке и разработке бдау (Базе Данных Арбитражного Управляющего, работающей «в веб браузере»)...
Курсовая работа по биоинформатике icon6. Курсовая работа выполняется под руководством преподавателя  научного руководите
Курсовая  работа  выполняется  студентами  2,3  года обучения  очного  и  заочного отде
Курсовая работа по биоинформатике iconКурсовая работа
В соответствии с учебным планом, студенты во время обучения самостоятельно выполняют две курсовые работы: в 4 и 6 семестрах. Курсовая...
Курсовая работа по биоинформатике iconКурсовая работа    тема:  Реализация интерфейсов мультиагентной системы  обучения программированию     Общие положения    Курсовая работа (проект) и лабораторный практикум предусматривают возможность 
Для  этого  после  титульного  листа  приводится  список  исполнителей  с  указанием 
Разместите кнопку на своём сайте:
TopReferat


База данных защищена авторским правом ©topreferat.znate.ru 2012
обратиться к администрации
ТопРеферат
Главная страница